PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 493689
Common NameARALYDRAFT_493689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 289aa    MW: 32691.7 Da    PI: 7.5417
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
493689genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-163579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E+e++v+a k++G   W++I +++g ++t+ q++s+ qk+
           493689 35 REKWTEAEHEKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 79
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-162983IPR009057Homeodomain-like
PROSITE profilePS5129420.7053084IPR017930Myb domain
TIGRFAMsTIGR015571.5E-163382IPR006447Myb domain, plants
SMARTSM007171.6E-123482IPR001005SANT/Myb domain
PfamPF002491.6E-133578IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-93575IPR009057Homeodomain-like
CDDcd001673.14E-93780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAMQERCESL CDELISSTDA FYLKTRKPYT ITKQREKWTE AEHEKFVEAL KLYGRAWRRI  60
EEHVGTKTAV QIRSHAQKFF TKVARDFGVS SESIEIPPPR PKRKPMHPYP RKLVIPDAKE  120
MAYVELTGSK MVQDEDNRSP TSVLSAHGSD GLGSIGSNSP NSSSAELSSH TEESLSPEAE  180
TKQSLKLFGK TFIVGDYNSS TSSDDSEDLK KKLDSETQSV QCSSCTSENA ETEVTRLVVS  240
EFKRSERSAF SQLKSSVTEM NNMRGFMPYK KRVKVEENID NVKMSYALW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195150.0AY519515.1 Arabidopsis thaliana MYB transcription factor (At5g37260) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002868495.10.0hypothetical protein ARALYDRAFT_493689, partial
SwissprotF4K5X60.0RVE2_ARATH; Protein REVEILLE 2
TrEMBLD7MI690.0D7MI69_ARALL; Putative uncharacterized protein (Fragment)
STRINGfgenesh2_kg.7__3122__AT5G37260.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144321922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.11e-157MYB_related family protein